Recombinant Human KPNA6 protein, GST-tagged
Cat.No. : | KPNA6-301478H |
Product Overview : | Recombinant Human KPNA6 (185-536 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Glu185-Leu536 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | EQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | KPNA6 karyopherin alpha 6 (importin alpha 7) [ Homo sapiens ] |
Official Symbol | KPNA6 |
Synonyms | KPNA6; karyopherin alpha 6 (importin alpha 7); importin subunit alpha-7; FLJ11249; IPOA7; KPNA7; MGC17918; importin-alpha-S2; importin alpha 7 subunit; karyopherin subunit alpha-6; |
Gene ID | 23633 |
mRNA Refseq | NM_012316 |
Protein Refseq | NP_036448 |
MIM | 610563 |
UniProt ID | O60684 |
◆ Recombinant Proteins | ||
KPNA6-8801M | Recombinant Mouse KPNA6 Protein | +Inquiry |
Kpna6-1721M | Recombinant Mouse Kpna6 Protein, His-tagged | +Inquiry |
KPNA6-1696HFL | Recombinant Full Length Human KPNA6 Protein, C-Flag-tagged | +Inquiry |
KPNA6-2065C | Recombinant Chicken KPNA6 | +Inquiry |
KPNA6-301478H | Recombinant Human KPNA6 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA6-4887HCL | Recombinant Human KPNA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KPNA6 Products
Required fields are marked with *
My Review for All KPNA6 Products
Required fields are marked with *
0
Inquiry Basket