Recombinant Human KPNA6 protein, GST-tagged
| Cat.No. : | KPNA6-1882H |
| Product Overview : | Recombinant Human KPNA6 protein(54-100 aa), fused to GST tag, was expressed in E. coli. |
| Availability | September 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 54-100 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | ELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLAT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | KPNA6 karyopherin alpha 6 (importin alpha 7) [ Homo sapiens ] |
| Official Symbol | KPNA6 |
| Synonyms | KPNA6; karyopherin alpha 6 (importin alpha 7); importin subunit alpha-7; FLJ11249; IPOA7; KPNA7; MGC17918; importin-alpha-S2; importin alpha 7 subunit; karyopherin subunit alpha-6; |
| Gene ID | 23633 |
| mRNA Refseq | NM_012316 |
| Protein Refseq | NP_036448 |
| MIM | 610563 |
| UniProt ID | O60684 |
| ◆ Recombinant Proteins | ||
| KPNA6-8801M | Recombinant Mouse KPNA6 Protein | +Inquiry |
| KPNA6-1882H | Recombinant Human KPNA6 protein, GST-tagged | +Inquiry |
| Kpna6-1721M | Recombinant Mouse Kpna6 Protein, His-tagged | +Inquiry |
| KPNA6-4880H | Recombinant Human KPNA6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KPNA6-2263R | Recombinant Rhesus Macaque KPNA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KPNA6-4887HCL | Recombinant Human KPNA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNA6 Products
Required fields are marked with *
My Review for All KPNA6 Products
Required fields are marked with *
