Recombinant Human KPNA7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KPNA7-728H |
Product Overview : | KPNA7 MS Standard C13 and N15-labeled recombinant protein (NP_001139187) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import, but exhibits different nuclear localization signal binding specificity compared to other members of the family. A pseudogene of this gene has been defined on chromosome 5. |
Molecular Mass : | 56.8 kDa |
AA Sequence : | MPTLDAPEERRRKFKYRGKDVSLRRQQRMAVSLELRKAKKDEQTLKRRNITSFCPDTPSEKTAKGVAVSLTLGEIIKGVNSSDPVLCFQATQTARKMLSQEKNPPLKLVIEAGLIPRMVEFLKSSLYPCLQFEAAWALTNIASGTSEQTRAVVEGGAIQPLIELLSSSNVAVCEQAVWALGNIAGDGPEFRDNVITSNAIPHLLALISPTLPITFLRNITWTLSNLCRNKNPYPCDTAVKQILPALLHLLQHQDSEVLSDACWALSYLTDGSNKRIGQVVNTGVLPRLVVLMTSSELNVLTPSLRTVGNIVTGTDEQTQMAIDAGMLNVLPQLLQHNKPSIQKEAAWALSNVAAGPCHHIQQLLAYDVLPPLVALLKNGEFKVQKEAVWMVANFATGATMDQLIQLVHSGVLEPLVNLLTAPDVKIVLIILDVISCILQAAEKRSEKENLCLLIEELGGIDRIEALQLHENRQIGQSALNIIEKHFGEEEDESQTLLSQVIDQDYEFIDYECLAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KPNA7 karyopherin subunit alpha 7 [ Homo sapiens (human) ] |
Official Symbol | KPNA7 |
Synonyms | KPNA7; karyopherin subunit alpha 7; IPOA8; importin subunit alpha-8; karyopherin alpha 7 |
Gene ID | 402569 |
mRNA Refseq | NM_001145715 |
Protein Refseq | NP_001139187 |
MIM | 614107 |
UniProt ID | A9QM74 |
◆ Recombinant Proteins | ||
KPNA7-4900M | Recombinant Mouse KPNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
KPNA7-12299Z | Recombinant Zebrafish KPNA7 | +Inquiry |
KPNA7-685H | Recombinant Human KPNA7 Protein, MYC/DDK-tagged | +Inquiry |
KPNA7-8802M | Recombinant Mouse KPNA7 Protein | +Inquiry |
Kpna7-3729M | Recombinant Mouse Kpna7 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNA7 Products
Required fields are marked with *
My Review for All KPNA7 Products
Required fields are marked with *
0
Inquiry Basket