Recombinant Human KPNB1 protein, His-tagged
Cat.No. : | KPNB1-6744H |
Product Overview : | Recombinant Human KPNB1 protein(408-605 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 408-605 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | QAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISD |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | KPNB1 karyopherin (importin) beta 1 [ Homo sapiens ] |
Official Symbol | KPNB1 |
Synonyms | KPNB1; karyopherin (importin) beta 1; importin subunit beta-1; IMB1; Impnb; importin 1; IPO1; IPOB; MGC2155; MGC2156; MGC2157; NTF97; PTAC97; importin 90; importin-90; nuclear factor p97; importin beta-1 subunit; karyopherin subunit beta-1; pore targeting complex 97 kDa subunit; |
Gene ID | 3837 |
mRNA Refseq | NM_002265 |
Protein Refseq | NP_002256 |
MIM | 602738 |
UniProt ID | Q14974 |
◆ Recombinant Proteins | ||
KPNB1-4901M | Recombinant Mouse KPNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KPNB1-6744H | Recombinant Human KPNB1 protein, His-tagged | +Inquiry |
KPNB1-5841HF | Recombinant Full Length Human KPNB1 Protein, GST-tagged | +Inquiry |
KPNB1-609M | Recombinant Mouse KPNB1 Protein (1-876 aa), His-tagged | +Inquiry |
KPNB1-3594Z | Recombinant Zebrafish KPNB1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNB1 Products
Required fields are marked with *
My Review for All KPNB1 Products
Required fields are marked with *