Recombinant Human KPNB1 protein, GST-tagged
| Cat.No. : | KPNB1-6745H |
| Product Overview : | Recombinant Human KPNB1 protein(408-605 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 408-605 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | QAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | KPNB1 karyopherin (importin) beta 1 [ Homo sapiens ] |
| Official Symbol | KPNB1 |
| Synonyms | KPNB1; karyopherin (importin) beta 1; importin subunit beta-1; IMB1; Impnb; importin 1; IPO1; IPOB; MGC2155; MGC2156; MGC2157; NTF97; PTAC97; importin 90; importin-90; nuclear factor p97; importin beta-1 subunit; karyopherin subunit beta-1; pore targeting complex 97 kDa subunit; |
| Gene ID | 3837 |
| mRNA Refseq | NM_002265 |
| Protein Refseq | NP_002256 |
| MIM | 602738 |
| UniProt ID | Q14974 |
| ◆ Recombinant Proteins | ||
| KPNB1-4901M | Recombinant Mouse KPNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KPNB1-6744H | Recombinant Human KPNB1 protein, His-tagged | +Inquiry |
| KPNB1-5841HF | Recombinant Full Length Human KPNB1 Protein, GST-tagged | +Inquiry |
| KPNB1-2960R | Recombinant Rat KPNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KPNB1-609M | Recombinant Mouse KPNB1 Protein (1-876 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPNB1 Products
Required fields are marked with *
My Review for All KPNB1 Products
Required fields are marked with *
