Recombinant Human KPTN Protein, GST-tagged
| Cat.No. : | KPTN-4889H |
| Product Overview : | Human KPTN full-length ORF ( AAH09249, 1 a.a. - 436 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a filamentous-actin-associated protein, which is involved in actin dynamics and plays an important role in neuromorphogenesis. Mutations in this gene result in recessive mental retardation-41. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2014] |
| Molecular Mass : | 73.7 kDa |
| AA Sequence : | MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KPTN kaptin (actin binding protein) [ Homo sapiens ] |
| Official Symbol | KPTN |
| Synonyms | KPTN; kaptin (actin binding protein); kaptin; 2E4; actin-associated protein 2E4; kaptin (actin-binding protein); |
| Gene ID | 11133 |
| mRNA Refseq | NM_007059 |
| Protein Refseq | NP_008990 |
| UniProt ID | Q9Y664 |
| ◆ Recombinant Proteins | ||
| KPTN-4089H | Recombinant Human KPTN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KPTN-444H | Recombinant Human KPTN protein, His-tagged | +Inquiry |
| Kptn-3730M | Recombinant Mouse Kptn Protein, Myc/DDK-tagged | +Inquiry |
| KPTN-1061Z | Recombinant Zebrafish KPTN | +Inquiry |
| KPTN-4889H | Recombinant Human KPTN Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KPTN-4886HCL | Recombinant Human KPTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPTN Products
Required fields are marked with *
My Review for All KPTN Products
Required fields are marked with *
