Recombinant Human KRAS G12D Protein, Avi Tag

Cat.No. : KRAS-14H
Product Overview : Recombinant human KRAS G12D protein (amino acids 1-185; G12D mutant variant of isoform 2B) with the N-terminal Avi Tag peptide and His-tag is produced in E. coli cells. Presence of Avi Tag peptide can be useful for a site-specific biotinylation with BirA enzyme.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Avi
Protein Length : 1-185
Description : Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development.
AA Sequence : MGSHHHHHHHHSNGLNDIFEAQKIEWHEMTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Purity : > 90% by Coomassie staining
Notes : This product is for laboratory research use only.
Storage : Storage is recommended at -20 centigrade for longer periods of time.
Concentration : 1.0 mg/mL by A280
Storage Buffer : 20 mM HEPES, pH 7.5, 250 mM NaCl, 5 mM 2-mercaptoethanol, 1 mM MgCl2 and 10% Glycerol
Shipping : Product requires shipping on ice packs.
Gene Name KRAS KRAS proto-oncogene, GTPase [ Homo sapiens (human) ]
Official Symbol KRAS
Synonyms KRAS; KRAS proto-oncogene, GTPase; NS; NS3; OES; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; K-Ras 2; 'C-K-RAS; c-Ki-ras; c-Ki-ras2; GTPase KRas; K-ras p21 protein; Kirsten rat sarcoma viral oncogene homolog; Kirsten rat sarcoma viral proto-oncogene; PR310 c-K-ras oncogene; c-Kirsten-ras protein; cellular c-Ki-ras2 proto-oncogene; cellular transforming proto-oncogene; oncogene KRAS2; proto-oncogene GTPase; transforming protein p21; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog; EC 3.6.5.3; KRAS G12D
Gene ID 3845
mRNA Refseq NM_033360
Protein Refseq NP_203524
MIM 190070
UniProt ID P01116

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRAS Products

Required fields are marked with *

My Review for All KRAS Products

Required fields are marked with *

0
cart-icon
0
compare icon