Recombinant Human KRAS Protein (1-186aa), N-His tagged
Cat.No. : | KRAS-33H |
Product Overview : | Recombinant human KRAS protein (1-186aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-186aa |
Description : | This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. |
Form : | Liquid |
Molecular Mass : | 23.8 kDa (210aa) confirmed by MALDI-TOF |
AA Sequence : | < MGSSHHHHHHSSGLVPRGSHMGSH> MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKC |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT |
Gene Name | KRAS v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog [ Homo sapiens (human) ] |
Official Symbol | KRAS |
Synonyms | KRAS; v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog; KRAS2, v Ki ras2 Kirsten rat sarcoma 2 viral oncogene homolog; GTPase KRas; KRAS1; K-Ras 2; c-Ki-ras; oncogene KRAS2; K-ras p21 protein; c-Kirsten-ras protein; PR310 c-K-ras oncogene; transforming protein p21; cellular c-Ki-ras2 proto-oncogene; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog; Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog; NS; NS3; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; |
Gene ID | 3845 |
mRNA Refseq | NM_033360 |
Protein Refseq | NP_203524 |
MIM | 190070 |
UniProt ID | P01116 |
◆ Recombinant Proteins | ||
KRAS-456HAF555 | Recombinant Human KRAS Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
KRAS-0959H | Recombinant Human KRAS Protein (T2-K169), GST tagged | +Inquiry |
KRAS-19H | Recombinant Human KRAS protein, His-tagged | +Inquiry |
KRAS-13H | Recombinant Human KRAS (G12D) Protein (1-186), N-His-tagged | +Inquiry |
KRAS-4376H | Recombinant Human KRAS Protein (Met1-Arg149), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRAS-4885HCL | Recombinant Human KRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRAS Products
Required fields are marked with *
My Review for All KRAS Products
Required fields are marked with *