Recombinant Human KRAS Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | KRAS-031H |
Product Overview : | KRAS MS Standard C13 and N15-labeled recombinant protein (NP_004976) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. |
Molecular Mass : | 21.2 kDa |
AA Sequence : | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKCVIMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KRAS KRAS proto-oncogene, GTPase [ Homo sapiens (human) ] |
Official Symbol | KRAS |
Synonyms | KRAS; KRAS proto-oncogene, GTPase; C-K-RAS; c-Ki-ras2; CFC2; K-Ras; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; KI-RAS; KRAS1; KRAS2; NS; NS3; RALD; RASK2; GTPase KRas; K-ras p21 protein; Kirsten rat sarcoma viral oncogene homolog; Kirsten rat sarcoma viral proto-oncogene; PR310 c-K-ras oncogene; c-Kirsten-ras protein; cellular c-Ki-ras2 proto-oncogene; cellular transforming proto-oncogene; oncogene KRAS2; transforming protein p21; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog; EC 3.6.5.2 |
Gene ID | 3845 |
mRNA Refseq | NM_004985 |
Protein Refseq | NP_004976 |
MIM | 190070 |
UniProt ID | P01116 |
◆ Recombinant Proteins | ||
KRAS-457H | Recombinant Human KRAS protein(G12C, Q61H), His-tagged | +Inquiry |
KRAS-080H | Recombinant Human KRAS G12S mutant Protein, DYKDDDDK-tagged | +Inquiry |
KRAS-456HAF555 | Recombinant Human KRAS Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
KRAS-0951H | Recombinant Human KRAS Protein (T2-K169, G12A), Tag Free | +Inquiry |
KRAS-3489H | Active Recombinant Human KRAS Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRAS-4885HCL | Recombinant Human KRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRAS Products
Required fields are marked with *
My Review for All KRAS Products
Required fields are marked with *
0
Inquiry Basket