Recombinant Human KRAS proto-oncogene, GTPase Protein, G12R Mutant, His&Avi tagged, Biotinylated
| Cat.No. : | KRAS-05H |
| Product Overview : | Recombinant KRAS G12R protein with the N-terminal AviTag peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Avi&His |
| Protein Length : | 1-185 aa |
| Description : | This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. |
| Tag : | N-Avi and His |
| Conjugation/Label : | Biotin |
| AA Sequence : | MTEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC |
| Purity : | > 90% by Coomassie staining |
| Storage : | At -70/-80 centigrade for longer periods of time. Minimize freeze/thaw cycles. Store on ice before use. The remaining, undiluted protein should be snap frozen in liquid nitrogen. |
| Concentration : | 1.0 mg/mL by A280 |
| Storage Buffer : | 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl2, 1 mM 2-mercapthoethanol, 10% glycerol. |
| Conjugation : | Biotin |
| Gene Name | KRAS KRAS proto-oncogene, GTPase [ Homo sapiens (human) ] |
| Official Symbol | KRAS |
| Synonyms | KRAS; KRAS proto-oncogene, GTPase; NS; NS3; OES; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; K-Ras 2; ''C-K-RAS; c-Ki-ras; c-Ki-ras2; GTPase KRas; K-ras p21 protein; KRAS-ENOPH fusion; Kirsten rat sarcoma viral oncogene homolog; Kirsten rat sarcoma viral proto-oncogene; Kras-Enoph1 fusion protein; PR310 c-K-ras oncogene; c-Kirsten-ras protein; cellular c-Ki-ras2 proto-oncogene; cellular transforming proto-oncogene; oncogene KRAS2; proto-oncogene GTPase; transforming protein p21; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog; EC 3.6.5.2 |
| Gene ID | 3845 |
| mRNA Refseq | NM_033360 |
| Protein Refseq | NP_203524 |
| MIM | 190070 |
| UniProt ID | P01116 |
| ◆ Recombinant Proteins | ||
| KRAS-11H | Recombinant Human KRAS G12V Protein, AviTag™, Biotinylated | +Inquiry |
| KRAS-02H | Recombinant Human KRAS (G12D) Protein, His-tagged | +Inquiry |
| KRAS-06H | Recombinant Human KRAS proto-oncogene, GTPase Protein, His&Avi tagged, Biotinylated | +Inquiry |
| KRAS-325H | Recombinant Human KRAS protein(Thr2-Cys185(61Q)), His-tagged | +Inquiry |
| KRAS-8806M | Recombinant Mouse KRAS Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KRAS-4885HCL | Recombinant Human KRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRAS Products
Required fields are marked with *
My Review for All KRAS Products
Required fields are marked with *



