Recombinant Human KRCC1 Protein, GST-tagged

Cat.No. : KRCC1-4885H
Product Overview : Human KRCC1 full-length ORF ( NP_057702.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : KRCC1 (Lysine Rich Coiled-Coil 1) is a Protein Coding gene. An important paralog of this gene is ZMAT1.
Molecular Mass : 57.4 kDa
AA Sequence : MKHSKKTYDSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGVEHRVYKHFSSDNSTSTHQASHKQIHQKRKRHPEEGREKSEEERSKHKRKKSCEEIDLDKHKSIQRKKTEVEIETVHVSTEKLKNRKEKKSRDVVSKKEERKRTKKKKEQGQERTEEEMLWDQSILGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRCC1 lysine-rich coiled-coil 1 [ Homo sapiens ]
Official Symbol KRCC1
Synonyms KRCC1; lysine-rich coiled-coil 1; lysine-rich coiled-coil protein 1; FLJ22333; cryptogenic hepatitis binding protein; cryptogenic hepatitis-binding protein 2; CHBP2;
Gene ID 51315
mRNA Refseq NM_016618
Protein Refseq NP_057702
UniProt ID Q9NPI7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRCC1 Products

Required fields are marked with *

My Review for All KRCC1 Products

Required fields are marked with *

0
cart-icon