Recombinant Human KRCC1 Protein, GST-tagged
Cat.No. : | KRCC1-4885H |
Product Overview : | Human KRCC1 full-length ORF ( NP_057702.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | KRCC1 (Lysine Rich Coiled-Coil 1) is a Protein Coding gene. An important paralog of this gene is ZMAT1. |
Molecular Mass : | 57.4 kDa |
AA Sequence : | MKHSKKTYDSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGVEHRVYKHFSSDNSTSTHQASHKQIHQKRKRHPEEGREKSEEERSKHKRKKSCEEIDLDKHKSIQRKKTEVEIETVHVSTEKLKNRKEKKSRDVVSKKEERKRTKKKKEQGQERTEEEMLWDQSILGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRCC1 lysine-rich coiled-coil 1 [ Homo sapiens ] |
Official Symbol | KRCC1 |
Synonyms | KRCC1; lysine-rich coiled-coil 1; lysine-rich coiled-coil protein 1; FLJ22333; cryptogenic hepatitis binding protein; cryptogenic hepatitis-binding protein 2; CHBP2; |
Gene ID | 51315 |
mRNA Refseq | NM_016618 |
Protein Refseq | NP_057702 |
UniProt ID | Q9NPI7 |
◆ Recombinant Proteins | ||
KRCC1-4905M | Recombinant Mouse KRCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRCC1-4885H | Recombinant Human KRCC1 Protein, GST-tagged | +Inquiry |
KRCC1-8808M | Recombinant Mouse KRCC1 Protein | +Inquiry |
KRCC1-3306R | Recombinant Rat KRCC1 Protein | +Inquiry |
KRCC1-2962R | Recombinant Rat KRCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRCC1-4884HCL | Recombinant Human KRCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRCC1 Products
Required fields are marked with *
My Review for All KRCC1 Products
Required fields are marked with *