Recombinant Human KRIT1 protein, His-tagged
Cat.No. : | KRIT1-2773H |
Product Overview : | Recombinant Human KRIT1 protein(471-585 aa), fused to His tag, was expressed in E. coli. |
Availability | August 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 471-585 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KRIT1 KRIT1, ankyrin repeat containing [ Homo sapiens ] |
Official Symbol | KRIT1 |
Synonyms | KRIT1; KRIT1, ankyrin repeat containing; CCM1, cerebral cavernous malformations 1; krev interaction trapped protein 1; CAM; krev interaction trapped 1; ankyrin repeat-containing protein Krit1; cerebral cavernous malformations 1 protein; CCM1; |
Gene ID | 889 |
mRNA Refseq | NM_001013406 |
Protein Refseq | NP_001013424 |
MIM | 604214 |
UniProt ID | O00522 |
◆ Recombinant Proteins | ||
KRIT1-8811M | Recombinant Mouse KRIT1 Protein | +Inquiry |
KRIT1-2773H | Recombinant Human KRIT1 protein, His-tagged | +Inquiry |
KRIT1-2660C | Recombinant Chicken KRIT1 | +Inquiry |
KRIT1-2265R | Recombinant Rhesus Macaque KRIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRIT1-4908M | Recombinant Mouse KRIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRIT1 Products
Required fields are marked with *
My Review for All KRIT1 Products
Required fields are marked with *