Recombinant Human KRT10 Protein (326-443 aa), His-tagged
Cat.No. : | KRT10-1436H |
Product Overview : | Recombinant Human KRT10 Protein (326-443 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 326-443 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 15.7 kDa |
AA Sequence : | EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | KRT10 keratin 10 [ Homo sapiens ] |
Official Symbol | KRT10 |
Synonyms | KRT10; keratin 10; CK10; cytokeratin 10; K10; CK-10; keratin-10; BIE; EHK; KPP; BCIE; |
Gene ID | 3858 |
mRNA Refseq | NM_000421 |
Protein Refseq | NP_000412 |
MIM | 148080 |
UniProt ID | P13645 |
◆ Recombinant Proteins | ||
Krt10-1808R | Recombinant Rat Krt10 protein, His & S-tagged | +Inquiry |
KRT10-3309R | Recombinant Rat KRT10 Protein | +Inquiry |
Krt10-1073M | Recombinant Mouse Krt10 Protein, His&GST-tagged | +Inquiry |
KRT10-1436H | Recombinant Human KRT10 Protein (326-443 aa), His-tagged | +Inquiry |
KRT10-2965R | Recombinant Rat KRT10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT10 Products
Required fields are marked with *
My Review for All KRT10 Products
Required fields are marked with *