Recombinant Human KRT28 Protein, GST-tagged
| Cat.No. : | KRT28-4857H | 
| Product Overview : | Human KRT28 full-length ORF ( AAI48795.1, 1 a.a. - 464 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. [provided by RefSeq | 
| Molecular Mass : | 77.99 kDa | 
| AA Sequence : | MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGSHAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKGWYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYENELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAGGNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAATFARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQAQIGALEEQLHQVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSPGNSSKDLSKTTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | KRT28 keratin 28 [ Homo sapiens (human) ] | 
| Official Symbol | KRT28 | 
| Synonyms | KRT28; keratin 28; KRT25D; K25IRS4; keratin, type I cytoskeletal 28; CK-28; K25D; K28; cytokeratin-28; keratin 28, type I; keratin-25D; type I inner root sheath specific keratin 25 irs4; type I inner root sheath-specific keratin-K25irs4 | 
| Gene ID | 162605 | 
| mRNA Refseq | NM_181535 | 
| Protein Refseq | NP_853513 | 
| MIM | 616677 | 
| UniProt ID | Q7Z3Y7 | 
| ◆ Recombinant Proteins | ||
| KRT28-3245H | Recombinant Human KRT28 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| KRT28-5979HF | Recombinant Full Length Human KRT28 Protein, GST-tagged | +Inquiry | 
| KRT28-4922M | Recombinant Mouse KRT28 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| KRT28-1522H | Recombinant Human KRT28 | +Inquiry | 
| Krt28-1600M | Recombinant Mouse Krt28 protein, His & GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| KRT28-954HCL | Recombinant Human KRT28 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT28 Products
Required fields are marked with *
My Review for All KRT28 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            