Recombinant Human KRT3 protein(181-510 aa), C-His-tagged
| Cat.No. : | KRT3-2640H |
| Product Overview : | Recombinant Human KRT3 protein(P12035)(181-510 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 181-510 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAAENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMDNNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIELNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEE |
| Gene Name | KRT3 keratin 3 [ Homo sapiens ] |
| Official Symbol | KRT3 |
| Gene ID | 3850 |
| mRNA Refseq | NM_057088 |
| Protein Refseq | NP_476429 |
| MIM | 148043 |
| UniProt ID | P12035 |
| ◆ Recombinant Proteins | ||
| KRT3-2641H | Recombinant Human KRT3 protein(201-530 aa), C-His-tagged | +Inquiry |
| KRT3-2640H | Recombinant Human KRT3 protein(181-510 aa), C-His-tagged | +Inquiry |
| KRT3-3246H | Recombinant Human KRT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRT3-2696H | Recombinant Human KRT3 protein, His & T7-tagged | +Inquiry |
| KRT3-254H | Recombinant Human KRT3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT3 Products
Required fields are marked with *
My Review for All KRT3 Products
Required fields are marked with *
