Recombinant Human KRT5 protein, His-tagged
Cat.No. : | KRT5-2708H |
Product Overview : | Recombinant Human KRT5 protein(316-491 aa), fused to His tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 316-491 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KRT5 keratin 5 [ Homo sapiens ] |
Official Symbol | KRT5 |
Synonyms | KRT5; keratin 5; EBS2, epidermolysis bullosa simplex 2 Dowling Meara/Kobner/Weber Cockayne types , keratin 5 (epidermolysis bullosa simplex, Dowling Meara/Kobner/Weber Cockayne types); keratin, type II cytoskeletal 5; KRT5A; CK-5; cytokeratin-5; 58 kda cytokeratin; type-II keratin Kb5; epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types; keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types); K5; CK5; DDD; EBS2; |
Gene ID | 3852 |
mRNA Refseq | NM_000424 |
Protein Refseq | NP_000415 |
MIM | 148040 |
UniProt ID | P13647 |
◆ Recombinant Proteins | ||
KRT5-737HF | Recombinant Full Length Human KRT5 Protein, GST-tagged | +Inquiry |
KRT5-8770Z | Recombinant Zebrafish KRT5 | +Inquiry |
KRT5-05H | Recombinant Human KRT5 protein, GST-tagged | +Inquiry |
KRT5-2982R | Recombinant Rat KRT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT5-4383H | Recombinant Human KRT5 Protein (Thr166-Leu474), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT5-4868HCL | Recombinant Human KRT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT5 Products
Required fields are marked with *
My Review for All KRT5 Products
Required fields are marked with *