Recombinant Human KRT5 protein, His-tagged

• Cat.No.: KRT5-2708H
• Product Overview: Recombinant Human KRT5 protein(316-491 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 316-491 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: KRT5 keratin 5 [ Homo sapiens ]
• Official Symbol: KRT5
• Synonyms: KRT5; keratin 5; EBS2, epidermolysis bullosa simplex 2 Dowling Meara/Kobner/Weber Cockayne types , keratin 5 (epidermolysis bullosa simplex, Dowling Meara/Kobner/Weber Cockayne types); keratin, type II cytoskeletal 5; KRT5A; CK-5; cytokeratin-5; 58 kda cytokeratin; type-II keratin Kb5; epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types; keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types); K5; CK5; DDD; EBS2
• Gene ID: 3852
• mRNA Refseq: NM_000424
• Protein Refseq: NP_000415
• MIM: 148040
• UniProt ID: P13647