Recombinant Human KRT5 protein, His-tagged

Cat.No. : KRT5-2708H
Product Overview : Recombinant Human KRT5 protein(316-491 aa), fused to His tag, was expressed in E. coli.
Availability July 03, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 316-491 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name KRT5 keratin 5 [ Homo sapiens ]
Official Symbol KRT5
Synonyms KRT5; keratin 5; EBS2, epidermolysis bullosa simplex 2 Dowling Meara/Kobner/Weber Cockayne types , keratin 5 (epidermolysis bullosa simplex, Dowling Meara/Kobner/Weber Cockayne types); keratin, type II cytoskeletal 5; KRT5A; CK-5; cytokeratin-5; 58 kda cytokeratin; type-II keratin Kb5; epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types; keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types); K5; CK5; DDD; EBS2;
Gene ID 3852
mRNA Refseq NM_000424
Protein Refseq NP_000415
MIM 148040
UniProt ID P13647

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRT5 Products

Required fields are marked with *

My Review for All KRT5 Products

Required fields are marked with *

0
cart-icon
0
compare icon