Recombinant Human KRT73 protein, GST-tagged
Cat.No. : | KRT73-3614H |
Product Overview : | Recombinant Human KRT73 protein(1-45 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-45 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MSRQFTYKSGPAAKGGFSGCSAVLSGGSSSSYRAGGKGLSGGFSS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KRT73 keratin 73 [ Homo sapiens (human) ] |
Official Symbol | KRT73 |
Synonyms | K73; CK-73; K6IRS3; IRT6IRS3; KRT6IRS3 |
Gene ID | 319101 |
mRNA Refseq | NM_175068.3 |
Protein Refseq | NP_778238.1 |
MIM | 608247 |
UniProt ID | Q86Y46 |
◆ Recombinant Proteins | ||
KRT73-8849M | Recombinant Mouse KRT73 Protein | +Inquiry |
KRT73-2985R | Recombinant Rat KRT73 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT73-3614H | Recombinant Human KRT73 protein, GST-tagged | +Inquiry |
KRT73-3329R | Recombinant Rat KRT73 Protein | +Inquiry |
KRT73-4937M | Recombinant Mouse KRT73 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRT73 Products
Required fields are marked with *
My Review for All KRT73 Products
Required fields are marked with *
0
Inquiry Basket