Recombinant Human KRT78 Protein, GST-tagged
Cat.No. : | KRT78-4837H |
Product Overview : | Human KRT78 full-length ORF ( AAI41555.1, 1 a.a. - 520 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the type II keratin gene family and encodes a protein with an intermediate filament domain. Keratins are the major structural proteins in epithelial cells, forming a cytoplasmic network of 10 to 12 nm wide intermediate filaments and creating a scaffold that gives cells the ability to withstand mechanical and non-mechanical stresses. The genes of the type II keratin family are located as a gene cluster at 12p13.13. Four pseudogenes of this gene family have been identified. [provided by RefSeq |
Molecular Mass : | 83.6 kDa |
AA Sequence : | MSLSPCRAQRGFSARSACSARSRGRSRGGFSSRGGFSSRSLNSFGGCLEGSRGSTWGSGGRLGVRFGEWSGGPGLSLCPPGGIQEVTINQNLLTPLKIEIDPQFQVVRTQETQEIRTLNNQFASFIDKVRFLEQQNKVLETKWHLLQQQGLSGSQQGLEPVFEACLDQLRKQLEQLQGERGALDAELKACRDQEEEYKSKYEEEAHRRATLENDFVVLKKDVDGVFLSKMELEGKLEALREYLYFLKHLNEEELGQLQTQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTKYQELQVSAQLHGDRMQETKVQISQLHQEIQRLQSQTENLKKQNASLQAAITDAEQRGELALKDAQAKVDELEAALRMAKQNLARLLCEYQELTSTKLSLDVEIATYRRLLEGEECRMSGECTSQVTISSVGGSAVMSGGVGGGLGSTCGLGSGKGSPGSCCTSIVTGGSNIILGSGKDPVLDSCSVSGSSAGSSCHTILKKTVESSLKTSITY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRT78 keratin 78 [ Homo sapiens (human) ] |
Official Symbol | KRT78 |
Synonyms | KRT78; keratin 78; K5B; K78; Kb40; CK-78; keratin, type II cytoskeletal 78; cytokeratin-78; keratin 78, type II; keratin-5b; type-II keratin Kb40 |
Gene ID | 196374 |
mRNA Refseq | NM_001300814 |
Protein Refseq | NP_001287743 |
MIM | 611159 |
UniProt ID | Q8N1N4 |
◆ Recombinant Proteins | ||
KRT78-4837H | Recombinant Human KRT78 Protein, GST-tagged | +Inquiry |
KRT78-6092HF | Recombinant Full Length Human KRT78 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT78 Products
Required fields are marked with *
My Review for All KRT78 Products
Required fields are marked with *