Recombinant Human KRT8 protein(71-410 aa), C-His-tagged
Cat.No. : | KRT8-2562H |
Product Overview : | Recombinant Human KRT8 protein(P05787)(71-410 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 71-410 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMS |
Gene Name | KRT8 keratin 8 [ Homo sapiens ] |
Official Symbol | KRT8 |
Synonyms | KRT8; keratin 8; keratin, type II cytoskeletal 8; CARD2; CK8; CYK8; K2C8; K8; KO; cytokeratin 8; cytokeratin-8; type-II keratin Kb8; CK-8; |
Gene ID | 3856 |
mRNA Refseq | NM_001256282 |
Protein Refseq | NP_001243211 |
MIM | 148060 |
UniProt ID | P05787 |
◆ Recombinant Proteins | ||
KRT8-3332R | Recombinant Rat KRT8 Protein | +Inquiry |
KRT8-4835H | Recombinant Human KRT8 Protein, GST-tagged | +Inquiry |
KRT8-42H | Recombinant Human KRT8 Protein, MYC/DDK-tagged | +Inquiry |
KRT8-144H | Recombinant Human Keratin 8 | +Inquiry |
KRT8-10433Z | Recombinant Zebrafish KRT8 | +Inquiry |
◆ Native Proteins | ||
KRT8-177B | Native bovine KRT8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT8-4862HCL | Recombinant Human KRT8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT8 Products
Required fields are marked with *
My Review for All KRT8 Products
Required fields are marked with *