Recombinant Human KRT8 protein(71-410 aa), C-His-tagged

Cat.No. : KRT8-2562H
Product Overview : Recombinant Human KRT8 protein(P05787)(71-410 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 71-410 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMS
Gene Name KRT8 keratin 8 [ Homo sapiens ]
Official Symbol KRT8
Synonyms KRT8; keratin 8; keratin, type II cytoskeletal 8; CARD2; CK8; CYK8; K2C8; K8; KO; cytokeratin 8; cytokeratin-8; type-II keratin Kb8; CK-8;
Gene ID 3856
mRNA Refseq NM_001256282
Protein Refseq NP_001243211
MIM 148060
UniProt ID P05787

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRT8 Products

Required fields are marked with *

My Review for All KRT8 Products

Required fields are marked with *

0
cart-icon