Recombinant Human KRTAP1-5 Protein, GST-tagged

Cat.No. : KRTAP1-5-4821H
Product Overview : Human KRTAP1-5 full-length ORF ( NP_114163.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-174 a.a.
Description : This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq
Molecular Mass : 44.4 kDa
AA Sequence : MTCCQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQPSCCETSCCQPSCCETSCCQPSCCQISSCGTGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTPPSCCQLHHAQASCCRPSYCGQSCCRPVCCCEPTC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP1-5 keratin associated protein 1-5 [ Homo sapiens ]
Official Symbol KRTAP1-5
Synonyms KRTAP1-5; keratin associated protein 1-5; keratin-associated protein 1-5; KAP1.5; keratin associated protein 1.5; keratin-associated protein 1.5; high sulfur keratin-associated protein 1.5; KRTAP1.5; MGC126604;
Gene ID 83895
mRNA Refseq NM_031957
Protein Refseq NP_114163
MIM 608822
UniProt ID Q9BYS1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP1-5 Products

Required fields are marked with *

My Review for All KRTAP1-5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon