Recombinant Human KRTAP10-2 Protein, GST-tagged
| Cat.No. : | KRTAP10-2-4828H |
| Product Overview : | Human KRTAP10-2 full-length ORF ( AAI46566.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-255 a.a. |
| Description : | This gene encodes a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This gene encodes a member of the high sulfur KAP family. It is localized to a cluster of intronless KAPs at 21q22.3 which are located within the introns of the C21orf29 gene. [provided by RefSeq |
| Molecular Mass : | 55 kDa |
| AA Sequence : | MAASTMSICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCGASSCCQQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCCQQSSCQPACCTSSPCQQSCCVSVCCKPVCCKSICCVPVCSGASSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPVCSRPASCSFSSGQKSSC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRTAP10-2 keratin associated protein 10-2 [ Homo sapiens (human) ] |
| Official Symbol | KRTAP10-2 |
| Synonyms | KRTAP10-2; keratin associated protein 10-2; KAP10.2; KAP18-2; KAP18.2; KRTAP10.2; KRTAP18-2; KRTAP18.2; keratin-associated protein 10-2; high sulfur keratin-associated protein 10.2; keratin-associated protein 18-2; keratin-associated protein 18.2 |
| Gene ID | 386679 |
| mRNA Refseq | NM_198693 |
| Protein Refseq | NP_941966 |
| UniProt ID | P60368 |
| ◆ Recombinant Proteins | ||
| KRTAP10-2-5793HF | Recombinant Full Length Human KRTAP10-2 Protein, GST-tagged | +Inquiry |
| KRTAP10-2-4828H | Recombinant Human KRTAP10-2 Protein, GST-tagged | +Inquiry |
| KRTAP10-2-3255H | Recombinant Human KRTAP10-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRTAP10-2-1307H | Recombinant Human KRTAP10-2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KRTAP10-2-960HCL | Recombinant Human KRTAP10-2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP10-2 Products
Required fields are marked with *
My Review for All KRTAP10-2 Products
Required fields are marked with *
