Recombinant Human KRTAP10-2 Protein, GST-tagged

Cat.No. : KRTAP10-2-4828H
Product Overview : Human KRTAP10-2 full-length ORF ( AAI46566.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-255 a.a.
Description : This gene encodes a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This gene encodes a member of the high sulfur KAP family. It is localized to a cluster of intronless KAPs at 21q22.3 which are located within the introns of the C21orf29 gene. [provided by RefSeq
Molecular Mass : 55 kDa
AA Sequence : MAASTMSICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCGASSCCQQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCCQQSSCQPACCTSSPCQQSCCVSVCCKPVCCKSICCVPVCSGASSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPVCSRPASCSFSSGQKSSC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP10-2 keratin associated protein 10-2 [ Homo sapiens (human) ]
Official Symbol KRTAP10-2
Synonyms KRTAP10-2; keratin associated protein 10-2; KAP10.2; KAP18-2; KAP18.2; KRTAP10.2; KRTAP18-2; KRTAP18.2; keratin-associated protein 10-2; high sulfur keratin-associated protein 10.2; keratin-associated protein 18-2; keratin-associated protein 18.2
Gene ID 386679
mRNA Refseq NM_198693
Protein Refseq NP_941966
UniProt ID P60368

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP10-2 Products

Required fields are marked with *

My Review for All KRTAP10-2 Products

Required fields are marked with *

0
cart-icon