Recombinant Human KRTAP10-6 Protein, GST-tagged

Cat.No. : KRTAP10-6-4827H
Product Overview : Human KRTAP10-6 full-length ORF ( AAI60131.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-365 a.a.
Description : KRTAP10-6 (Keratin Associated Protein 10-6) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. An important paralog of this gene is KRTAP10-7.
Molecular Mass : 40.2 kDa
AA Sequence : MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCTSSCTPSCCQQSSCQPTCCTSSPCQQACCVPVCCVPVCCVPTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQPACCTASCCRPSSSVSLLCHPVCKSTCCVPVPSCGASASSCQPSCCRTASCVSLLCRPMCSRPACYSLCSGQKSSC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP10-6 keratin associated protein 10-6 [ Homo sapiens (human) ]
Official Symbol KRTAP10-6
Synonyms KRTAP10-6; keratin associated protein 10-6; KAP10.6; KAP18.6; KRTAP18-6; KRTAP18.6; keratin-associated protein 10-6; high sulfur keratin-associated protein 10.6; keratin associated protein 18-6
Gene ID 386674
mRNA Refseq NM_198688
Protein Refseq NP_941961
UniProt ID P60371

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP10-6 Products

Required fields are marked with *

My Review for All KRTAP10-6 Products

Required fields are marked with *

0
cart-icon
0
compare icon