Recombinant Human KRTAP10-6 Protein, GST-tagged
Cat.No. : | KRTAP10-6-4827H |
Product Overview : | Human KRTAP10-6 full-length ORF ( AAI60131.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-365 a.a. |
Description : | KRTAP10-6 (Keratin Associated Protein 10-6) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. An important paralog of this gene is KRTAP10-7. |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCTSSCTPSCCQQSSCQPTCCTSSPCQQACCVPVCCVPVCCVPTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQPACCTASCCRPSSSVSLLCHPVCKSTCCVPVPSCGASASSCQPSCCRTASCVSLLCRPMCSRPACYSLCSGQKSSC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP10-6 keratin associated protein 10-6 [ Homo sapiens (human) ] |
Official Symbol | KRTAP10-6 |
Synonyms | KRTAP10-6; keratin associated protein 10-6; KAP10.6; KAP18.6; KRTAP18-6; KRTAP18.6; keratin-associated protein 10-6; high sulfur keratin-associated protein 10.6; keratin associated protein 18-6 |
Gene ID | 386674 |
mRNA Refseq | NM_198688 |
Protein Refseq | NP_941961 |
UniProt ID | P60371 |
◆ Recombinant Proteins | ||
KRTAP10-6-5796HF | Recombinant Full Length Human KRTAP10-6 Protein, GST-tagged | +Inquiry |
KRTAP10-6-4827H | Recombinant Human KRTAP10-6 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP10-6 Products
Required fields are marked with *
My Review for All KRTAP10-6 Products
Required fields are marked with *