Recombinant Human KRTAP3-2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | KRTAP3-2-3062H |
| Product Overview : | KRTAP3 MS Standard C13 and N15-labeled recombinant protein (NP_114165) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. |
| Molecular Mass : | 10.4 kDa |
| AA Sequence : | MDCCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPRGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | KRTAP3-2 keratin associated protein 3-2 [ Homo sapiens (human) ] |
| Official Symbol | KRTAP3-2 |
| Synonyms | KRTAP3-2; keratin associated protein 3-2; KAP3.2; KRTAP3.2; keratin-associated protein 3-2; high sulfur keratin-associated protein 3.2; keratin associated protein 3.2 |
| Gene ID | 83897 |
| mRNA Refseq | NM_031959 |
| Protein Refseq | NP_114165 |
| UniProt ID | Q9BYR7 |
| ◆ Recombinant Proteins | ||
| KRTAP3-2-3289H | Recombinant Human KRTAP3-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRTAP3-2-1571H | Recombinant Human KRTAP3-2 | +Inquiry |
| KRTAP3-2-4814H | Recombinant Human KRTAP3-2 Protein, GST-tagged | +Inquiry |
| KRTAP3-2-3062H | Recombinant Human KRTAP3-2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KRTAP3-2-4957M | Recombinant Mouse KRTAP3-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP3-2 Products
Required fields are marked with *
My Review for All KRTAP3-2 Products
Required fields are marked with *



