Recombinant Human KXD1 Protein, GST-tagged
Cat.No. : | KXD1-4332H |
Product Overview : | Human MGC2749 full-length ORF ( NP_076974.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | KXD1 (KxDL Motif Containing 1) is a Protein Coding gene. |
Molecular Mass : | 46 kDa |
AA Sequence : | MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KXD1 KxDL motif containing 1 [ Homo sapiens (human) ] |
Official Symbol | KXD1 |
Synonyms | KXD1; KxDL motif containing 1; KXDL; BORCS4; MST096; MSTP096; C10orf50; C19orf50; kxDL motif-containing protein 1; UPF0459 protein C19orf50 |
Gene ID | 79036 |
mRNA Refseq | NM_001171948 |
Protein Refseq | NP_001165419 |
MIM | 615178 |
UniProt ID | Q9BQD3 |
◆ Recombinant Proteins | ||
KXD1-1013H | Recombinant Human KXD1 Protein, GST/His-tagged | +Inquiry |
KXD1-15913H | Recombinant Human KXD1, His-tagged | +Inquiry |
KXD1-2993R | Recombinant Rat KXD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KXD1-915Z | Recombinant Zebrafish KXD1 | +Inquiry |
KXD1-6176HF | Recombinant Full Length Human KXD1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KXD1-8203HCL | Recombinant Human C19orf50 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KXD1 Products
Required fields are marked with *
My Review for All KXD1 Products
Required fields are marked with *