Recombinant Human LACC1 protein, His-tagged
Cat.No. : | LACC1-3068H |
Product Overview : | Recombinant Human LACC1 protein, fused to His tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NISYERDGEQDNCEIETSNGLSALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRGGLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LACC1 laccase (multicopper oxidoreductase) domain containing 1 [ Homo sapiens ] |
Official Symbol | LACC1 |
Synonyms | LACC1; laccase (multicopper oxidoreductase) domain containing 1; C13orf31, chromosome 13 open reading frame 31; laccase domain-containing protein 1; FLJ38725; C13orf31; RP11-5G9.2; DKFZp686D11119; |
Gene ID | 144811 |
mRNA Refseq | NM_001128303 |
Protein Refseq | NP_001121775 |
MIM | 613409 |
UniProt ID | Q8IV20 |
◆ Recombinant Proteins | ||
LACC1-1338H | Recombinant Human LACC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LACC1-4329H | Recombinant Human LACC1 Protein, GST-tagged | +Inquiry |
LACC1-445HFL | Active Recombinant Full Length Human LACC1 Protein, C-Flag-tagged | +Inquiry |
LACC1-1273H | Recombinant Human LACC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LACC1-5062HF | Recombinant Full Length Human LACC1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LACC1-8298HCL | Recombinant Human C13orf31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LACC1 Products
Required fields are marked with *
My Review for All LACC1 Products
Required fields are marked with *