Recombinant Human LACC1 protein, His-tagged
| Cat.No. : | LACC1-3068H |
| Product Overview : | Recombinant Human LACC1 protein, fused to His tag, was expressed in E. coli. |
| Availability | July 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | NISYERDGEQDNCEIETSNGLSALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRGGLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDG |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LACC1 laccase (multicopper oxidoreductase) domain containing 1 [ Homo sapiens ] |
| Official Symbol | LACC1 |
| Synonyms | LACC1; laccase (multicopper oxidoreductase) domain containing 1; C13orf31, chromosome 13 open reading frame 31; laccase domain-containing protein 1; FLJ38725; C13orf31; RP11-5G9.2; DKFZp686D11119; |
| Gene ID | 144811 |
| mRNA Refseq | NM_001128303 |
| Protein Refseq | NP_001121775 |
| MIM | 613409 |
| UniProt ID | Q8IV20 |
| ◆ Recombinant Proteins | ||
| Lacc1-3746M | Recombinant Mouse Lacc1 Protein, Myc/DDK-tagged | +Inquiry |
| LACC1-4329H | Recombinant Human LACC1 Protein, GST-tagged | +Inquiry |
| LACC1-8921M | Recombinant Mouse LACC1 Protein | +Inquiry |
| LACC1-1273H | Recombinant Human LACC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LACC1-3068H | Recombinant Human LACC1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LACC1-8298HCL | Recombinant Human C13orf31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LACC1 Products
Required fields are marked with *
My Review for All LACC1 Products
Required fields are marked with *




