Recombinant Human LAD1

Cat.No. : LAD1-28998TH
Product Overview : Recombinant fragment of Human LAD1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene may be an anchoring filament that is a component of basement membranes. It may contribute to the stability of the association of the epithelial layers with the underlying mesenchyme.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SESVKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRLSGVVTSRLNLWISRTQESGDQDPQEAQKASSATERTQWGQKSDSSLDAEV
Gene Name LAD1 ladinin 1 [ Homo sapiens ]
Official Symbol LAD1
Synonyms LAD1; ladinin 1; ladinin-1;
Gene ID 3898
mRNA Refseq NM_005558
Protein Refseq NP_005549
MIM 602314
Uniprot ID O00515
Chromosome Location 1q25.1-q32.3
Function structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAD1 Products

Required fields are marked with *

My Review for All LAD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon