Recombinant Human LAD1

• Cat.No.: LAD1-28998TH
• Product Overview: Recombinant fragment of Human LAD1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene may be an anchoring filament that is a component of basement membranes. It may contribute to the stability of the association of the epithelial layers with the underlying mesenchyme.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SESVKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRLSGVVTSRLNLWISRTQESGDQDPQEAQKASSATERTQWGQKSDSSLDAEV

Gene Information

• Gene Name: LAD1 ladinin 1 [ Homo sapiens ]
• Official Symbol: LAD1
• Synonyms: LAD1; ladinin 1; ladinin-1
• Gene ID: 3898
• mRNA Refseq: NM_005558
• Protein Refseq: NP_005549
• MIM: 602314
• Uniprot ID: O00515
• Chromosome Location: 1q25.1-q32.3
• Function: structural molecule activity