Recombinant Human LAD1
Cat.No. : | LAD1-28998TH |
Product Overview : | Recombinant fragment of Human LAD1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene may be an anchoring filament that is a component of basement membranes. It may contribute to the stability of the association of the epithelial layers with the underlying mesenchyme. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SESVKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRLSGVVTSRLNLWISRTQESGDQDPQEAQKASSATERTQWGQKSDSSLDAEV |
Gene Name | LAD1 ladinin 1 [ Homo sapiens ] |
Official Symbol | LAD1 |
Synonyms | LAD1; ladinin 1; ladinin-1; |
Gene ID | 3898 |
mRNA Refseq | NM_005558 |
Protein Refseq | NP_005549 |
MIM | 602314 |
Uniprot ID | O00515 |
Chromosome Location | 1q25.1-q32.3 |
Function | structural molecule activity; |
◆ Recombinant Proteins | ||
LAD1-169H | Recombinant Human LAD1 Protein, MYC/DDK-tagged | +Inquiry |
LAD1-1274H | Recombinant Human LAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAD1-28998TH | Recombinant Human LAD1 | +Inquiry |
LAD1-7886H | Recombinant Human LAD1 protein, His & GST-tagged | +Inquiry |
Lad1-1726M | Recombinant Mouse Lad1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAD1 Products
Required fields are marked with *
My Review for All LAD1 Products
Required fields are marked with *