Recombinant Human LAMA2 protein, GST-tagged

Cat.No. : LAMA2-27944TH
Product Overview : Recombinant Human LAMA2(3013 a.a. - 3122 a.a.) fussed with GST tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 3013-3122 a.a.
Description : Laminin, an extracellular protein, is a major component of the basement membrane. It is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. It is composed of three subunits, alpha, beta, and gamma, which are bound to each other by disulfide bonds into a cross-shaped molecule. This gene encodes the alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Mutations in this gene have been identified as the cause of congenital merosin-deficient muscular dystrophy. Two transcript variants encoding different proteins have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGC IRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name LAMA2 laminin, alpha 2 [ Homo sapiens ]
Official Symbol LAMA2
Synonyms LAMA2; laminin, alpha 2; LAMM; laminin subunit alpha-2; congenital muscular dystrophy; merosin; laminin M chain; merosin heavy chain; laminin-2 subunit alpha; laminin-4 subunit alpha; laminin-12 subunit alpha;
Gene ID 3908
mRNA Refseq NM_000426
Protein Refseq NP_000417
MIM 156225
UniProt ID P24043
Chromosome Location 6q22-q23
Pathway Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem;
Function receptor binding; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAMA2 Products

Required fields are marked with *

My Review for All LAMA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon