Recombinant Human LAMA2 protein, GST-tagged
Cat.No. : | LAMA2-27944TH |
Product Overview : | Recombinant Human LAMA2(3013 a.a. - 3122 a.a.) fussed with GST tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 3013-3122 a.a. |
Description : | Laminin, an extracellular protein, is a major component of the basement membrane. It is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. It is composed of three subunits, alpha, beta, and gamma, which are bound to each other by disulfide bonds into a cross-shaped molecule. This gene encodes the alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Mutations in this gene have been identified as the cause of congenital merosin-deficient muscular dystrophy. Two transcript variants encoding different proteins have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGC IRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | LAMA2 laminin, alpha 2 [ Homo sapiens ] |
Official Symbol | LAMA2 |
Synonyms | LAMA2; laminin, alpha 2; LAMM; laminin subunit alpha-2; congenital muscular dystrophy; merosin; laminin M chain; merosin heavy chain; laminin-2 subunit alpha; laminin-4 subunit alpha; laminin-12 subunit alpha; |
Gene ID | 3908 |
mRNA Refseq | NM_000426 |
Protein Refseq | NP_000417 |
MIM | 156225 |
UniProt ID | P24043 |
Chromosome Location | 6q22-q23 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; |
Function | receptor binding; structural molecule activity; |
◆ Recombinant Proteins | ||
LAMA2-0367H | Active Recombinant Human LAMA2 protein, Fc-tagged | +Inquiry |
LAMA2-8310Z | Recombinant Zebrafish LAMA2 | +Inquiry |
LAMA2-27944TH | Recombinant Human LAMA2 protein, GST-tagged | +Inquiry |
Lama2-210M | Recombinant Mouse Lama2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMA2 Products
Required fields are marked with *
My Review for All LAMA2 Products
Required fields are marked with *