Recombinant Human LAMA5 Protein (3401-3692 aa), His-SUMO-tagged
Cat.No. : | LAMA5-1787H |
Product Overview : | Recombinant Human LAMA5 Protein (3401-3692 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 3401-3692 aa |
Description : | Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other Extracellular domain matrix components. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 47.1 kDa |
AA Sequence : | FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | LAMA5 laminin, alpha 5 [ Homo sapiens ] |
Official Symbol | LAMA5 |
Synonyms | LAMA5; laminin, alpha 5; laminin subunit alpha-5; laminin alpha-5 chain; KIAA1907; |
Gene ID | 3911 |
mRNA Refseq | NM_005560 |
Protein Refseq | NP_005551 |
MIM | 601033 |
UniProt ID | O15230 |
◆ Recombinant Proteins | ||
LAMA5-0356H | Active Recombinant Human LAMA5 protein, Fc-tagged | +Inquiry |
LAMA5-0375H | Active Recombinant Human LAMA5 protein, Fc-tagged | +Inquiry |
LAMA5-2384H | Recombinant Human LAMA5 Protein, His-tagged | +Inquiry |
LAMA5-1787H | Recombinant Human LAMA5 Protein (3401-3692 aa), His-SUMO-tagged | +Inquiry |
LAMA5-2461H | Recombinant Human LAMA5 protein(2381-2460 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMA5-968HCL | Recombinant Human LAMA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMA5 Products
Required fields are marked with *
My Review for All LAMA5 Products
Required fields are marked with *