Recombinant Human LAMC2 protein, His-GST & Myc-tagged

Cat.No. : LAMC2-4402H
Product Overview : Recombinant Human LAMC2 protein(Q13753)(417-588aa), fused to N-terminal His-GST tag and C-terminal Myc tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His&Myc
Protein Length : 417-588aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 53.3 kDa
AA Sequence : NCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSD
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name LAMC2 laminin, gamma 2 [ Homo sapiens ]
Official Symbol LAMC2
Synonyms LAMC2; laminin, gamma 2; EBR2, EBR2A, LAMB2T, laminin, gamma 2 (nicein (100kD), kalinin (105kD), BM600 (100kD), Herlitz junctional epidermolysis bullosa)) , LAMNB2; laminin subunit gamma-2; BM600 100kDa; kalinin 105kDa; nicein 100kDa; BM600-100kDa; laminin B2t chain; CSF 140 kDa subunit; nicein subunit gamma; kalinin subunit gamma; ladsin 140 kDa subunit; epiligrin subunit gamma; cell-scattering factor 140 kDa subunit; large adhesive scatter factor 140 kDa subunit; B2T; CSF; EBR2; BM600; EBR2A; LAMB2T; LAMNB2; MGC138491; MGC141938;
Gene ID 3918
mRNA Refseq NM_005562
Protein Refseq NP_005553
MIM 150292
UniProt ID Q13753

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAMC2 Products

Required fields are marked with *

My Review for All LAMC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon