Recombinant Human LAMTOR2, His-tagged
Cat.No. : | LAMTOR2-31332TH |
Product Overview : | Recombinant full length Human robld3 with an N terminal His tag; 149 amino acids with the tag, predicted mwt: 16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 125 amino acids |
Description : | The product of this gene is highly conserved with a mouse protein associated with the cytoplasmic face of late endosomes and lysosomes. The mouse protein interacts with MAPK scaffold protein 1, a component of the mitogen-activated protein kinase pathway. In humans, a mutation in this gene has been associated with a primary immunodeficiency syndrome, and suggests a role for this protein in endosomal biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 16.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS |
Gene Name | LAMTOR2 late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 [ Homo sapiens ] |
Official Symbol | LAMTOR2 |
Synonyms | LAMTOR2; late endosomal/lysosomal adaptor, MAPK and MTOR activator 2; roadblock domain containing 3 , ROBLD3; ragulator complex protein LAMTOR2; ENDAP; endosomal adaptor protein; MAPBPIP; MAPKSP1 adaptor protein; MAPKSP1AP; mitogen activated protein bindi |
Gene ID | 28956 |
mRNA Refseq | NM_001145264 |
Protein Refseq | NP_001138736 |
MIM | 610389 |
Uniprot ID | Q9Y2Q5 |
Chromosome Location | 1q22 |
Function | protein binding; |
◆ Recombinant Proteins | ||
LAMTOR2-4987M | Recombinant Mouse LAMTOR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAMTOR2-552H | Recombinant Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 2, His-tagged | +Inquiry |
LAMTOR2-983Z | Recombinant Zebrafish LAMTOR2 | +Inquiry |
Lamtor2-3750M | Recombinant Mouse Lamtor2 Protein, Myc/DDK-tagged | +Inquiry |
LAMTOR2-2280R | Recombinant Rhesus Macaque LAMTOR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMTOR2-2257HCL | Recombinant Human ROBLD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAMTOR2 Products
Required fields are marked with *
My Review for All LAMTOR2 Products
Required fields are marked with *
0
Inquiry Basket