Recombinant Human LAMTOR2, His-tagged
| Cat.No. : | LAMTOR2-31332TH |
| Product Overview : | Recombinant full length Human robld3 with an N terminal His tag; 149 amino acids with the tag, predicted mwt: 16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 125 amino acids |
| Description : | The product of this gene is highly conserved with a mouse protein associated with the cytoplasmic face of late endosomes and lysosomes. The mouse protein interacts with MAPK scaffold protein 1, a component of the mitogen-activated protein kinase pathway. In humans, a mutation in this gene has been associated with a primary immunodeficiency syndrome, and suggests a role for this protein in endosomal biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Conjugation : | HIS |
| Molecular Weight : | 16.000kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS |
| Gene Name | LAMTOR2 late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 [ Homo sapiens ] |
| Official Symbol | LAMTOR2 |
| Synonyms | LAMTOR2; late endosomal/lysosomal adaptor, MAPK and MTOR activator 2; roadblock domain containing 3 , ROBLD3; ragulator complex protein LAMTOR2; ENDAP; endosomal adaptor protein; MAPBPIP; MAPKSP1 adaptor protein; MAPKSP1AP; mitogen activated protein bindi |
| Gene ID | 28956 |
| mRNA Refseq | NM_001145264 |
| Protein Refseq | NP_001138736 |
| MIM | 610389 |
| Uniprot ID | Q9Y2Q5 |
| Chromosome Location | 1q22 |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| LAMTOR2-2280R | Recombinant Rhesus Macaque LAMTOR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LAMTOR2-8944M | Recombinant Mouse LAMTOR2 Protein | +Inquiry |
| LAMTOR2-4987M | Recombinant Mouse LAMTOR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LAMTOR2-552H | Recombinant Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 2, His-tagged | +Inquiry |
| LAMTOR2-31332TH | Recombinant Human LAMTOR2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LAMTOR2-2257HCL | Recombinant Human ROBLD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMTOR2 Products
Required fields are marked with *
My Review for All LAMTOR2 Products
Required fields are marked with *
