Recombinant Human LAMTOR3, His-tagged
Cat.No. : | LAMTOR3-28221TH |
Product Overview : | Recombinant full length Human MAP2K1IP1 (amino acids 1-124) with N terminal His tag; 144 amino acids with tag, MWt 15.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 124 amino acids |
Description : | This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 13. |
Conjugation : | HIS |
Molecular Weight : | 15.800kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 5mM DTT, 20mM Tris HCl, 100mM Sodium chloride, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS |
Gene Name | LAMTOR3 late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [ Homo sapiens ] |
Official Symbol | LAMTOR3 |
Synonyms | LAMTOR3; late endosomal/lysosomal adaptor, MAPK and MTOR activator 3; MAP2K1IP1, MAPK scaffold protein 1 , MAPKSP1, mitogen activated protein kinase kinase 1 interacting protein 1; ragulator complex protein LAMTOR3; MAPBP; MEK partner 1; MP1; Ragulator3 |
Gene ID | 8649 |
mRNA Refseq | NM_001243736 |
Protein Refseq | NP_001230665 |
MIM | 603296 |
Uniprot ID | Q9UHA4 |
Chromosome Location | 4q24-q26 |
Pathway | MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
LAMTOR3-4988M | Recombinant Mouse LAMTOR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAMTOR3-3352R | Recombinant Rat LAMTOR3 Protein | +Inquiry |
LAMTOR3-8945M | Recombinant Mouse LAMTOR3 Protein | +Inquiry |
LAMTOR3-5066H | Recombinant Human Late Endosomal/Lysosomal Adaptor And MAPK And MTOR Activator 3, His-tagged | +Inquiry |
LAMTOR3-5231H | Recombinant Human LAMTOR3 Protein (Met1-Ser124), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMTOR3-4482HCL | Recombinant Human MAPKSP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMTOR3 Products
Required fields are marked with *
My Review for All LAMTOR3 Products
Required fields are marked with *