Recombinant Human LANCL1 protein, His&Myc-tagged
Cat.No. : | LANCL1-3154H |
Product Overview : | Recombinant Human LANCL1 protein(O43813)(2-399aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-399aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.6 kDa |
AA Sequence : | AQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LANCL1 LanC lantibiotic synthetase component C-like 1 (bacterial) [ Homo sapiens ] |
Official Symbol | LANCL1 |
Synonyms | LANCL1; LanC lantibiotic synthetase component C-like 1 (bacterial); GPR69A, LanC (bacterial lantibiotic synthetase component C) like 1; lanC-like protein 1; p40; G protein-coupled receptor 69A; 40 kDa erythrocyte membrane protein; LanC (bacterial lantibiotic synthetase component); LanC (bacterial lantibiotic synthetase component C)-like 1; GPR69A; |
Gene ID | 10314 |
mRNA Refseq | NM_001136574 |
Protein Refseq | NP_001130046 |
MIM | 604155 |
UniProt ID | O43813 |
◆ Recombinant Proteins | ||
LANCL1-3353R | Recombinant Rat LANCL1 Protein | +Inquiry |
LANCL1-243H | Recombinant Human LANCL1, His-tagged | +Inquiry |
LANCL1-4989M | Recombinant Mouse LANCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LANCL1-2281R | Recombinant Rhesus Macaque LANCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LANCL1-393C | Recombinant Cynomolgus Monkey LANCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LANCL1-4826HCL | Recombinant Human LANCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LANCL1 Products
Required fields are marked with *
My Review for All LANCL1 Products
Required fields are marked with *