Recombinant Human LANCL1 protein, His&Myc-tagged
| Cat.No. : | LANCL1-3154H |
| Product Overview : | Recombinant Human LANCL1 protein(O43813)(2-399aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-399aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 52.6 kDa |
| AA Sequence : | AQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | LANCL1 LanC lantibiotic synthetase component C-like 1 (bacterial) [ Homo sapiens ] |
| Official Symbol | LANCL1 |
| Synonyms | LANCL1; LanC lantibiotic synthetase component C-like 1 (bacterial); GPR69A, LanC (bacterial lantibiotic synthetase component C) like 1; lanC-like protein 1; p40; G protein-coupled receptor 69A; 40 kDa erythrocyte membrane protein; LanC (bacterial lantibiotic synthetase component); LanC (bacterial lantibiotic synthetase component C)-like 1; GPR69A; |
| Gene ID | 10314 |
| mRNA Refseq | NM_001136574 |
| Protein Refseq | NP_001130046 |
| MIM | 604155 |
| UniProt ID | O43813 |
| ◆ Recombinant Proteins | ||
| LANCL1-3164H | Recombinant Human LANCL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LANCL1-2460R | Recombinant Rhesus monkey LANCL1 Protein, His-tagged | +Inquiry |
| LANCL1-1973Z | Recombinant Zebrafish LANCL1 | +Inquiry |
| LANCL1-2904C | Recombinant Chicken LANCL1 | +Inquiry |
| LANCL1-2281R | Recombinant Rhesus Macaque LANCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LANCL1-4826HCL | Recombinant Human LANCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LANCL1 Products
Required fields are marked with *
My Review for All LANCL1 Products
Required fields are marked with *



