Recombinant Human LANCL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LANCL1-3164H |
| Product Overview : | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130046) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Molecular Mass : | 45.3 kDa |
| AA Sequence : | MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LANCL1 LanC like 1 [ Homo sapiens (human) ] |
| Official Symbol | LANCL1 |
| Synonyms | LANCL1; LanC lantibiotic synthetase component C-like 1 (bacterial); GPR69A, LanC (bacterial lantibiotic synthetase component C) like 1; lanC-like protein 1; p40; G protein-coupled receptor 69A; 40 kDa erythrocyte membrane protein; LanC (bacterial lantibiotic synthetase component); LanC (bacterial lantibiotic synthetase component C)-like 1; GPR69A; |
| Gene ID | 10314 |
| mRNA Refseq | NM_001136574 |
| Protein Refseq | NP_001130046 |
| MIM | 604155 |
| UniProt ID | O43813 |
| ◆ Recombinant Proteins | ||
| LANCL1-1973Z | Recombinant Zebrafish LANCL1 | +Inquiry |
| LANCL1-243H | Recombinant Human LANCL1, His-tagged | +Inquiry |
| LANCL1-3154H | Recombinant Human LANCL1 protein, His&Myc-tagged | +Inquiry |
| LANCL1-3164H | Recombinant Human LANCL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LANCL1-2904C | Recombinant Chicken LANCL1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LANCL1-4826HCL | Recombinant Human LANCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LANCL1 Products
Required fields are marked with *
My Review for All LANCL1 Products
Required fields are marked with *
