Recombinant Human LAPTM5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LAPTM5-3237H |
Product Overview : | LAPTM5 MS Standard C13 and N15-labeled recombinant protein (NP_006753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis. |
Molecular Mass : | 29.9 kDa |
AA Sequence : | MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKKNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LAPTM5 lysosomal protein transmembrane 5 [ Homo sapiens (human) ] |
Official Symbol | LAPTM5 |
Synonyms | LAPTM5; lysosomal protein transmembrane 5; lysosomal multispanning membrane protein 5; lysosomal-associated transmembrane protein 5; retinoic acid-inducible E3 protein; human retinoic acid-inducible E3 protein; CD40-ligand-activated specific transcripts; lysosomal-associated multitransmembrane protein 5; lysosomal associated multispanning membrane protein 5; CLAST6; FLJ61683; FLJ97251; MGC125860; MGC125861; |
Gene ID | 7805 |
mRNA Refseq | NM_006762 |
Protein Refseq | NP_006753 |
MIM | 601476 |
UniProt ID | Q13571 |
◆ Cell & Tissue Lysates | ||
LAPTM5-375HCL | Recombinant Human LAPTM5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAPTM5 Products
Required fields are marked with *
My Review for All LAPTM5 Products
Required fields are marked with *