Recombinant Human LAPTM5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LAPTM5-3237H
Product Overview : LAPTM5 MS Standard C13 and N15-labeled recombinant protein (NP_006753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis.
Molecular Mass : 29.9 kDa
AA Sequence : MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKKNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LAPTM5 lysosomal protein transmembrane 5 [ Homo sapiens (human) ]
Official Symbol LAPTM5
Synonyms LAPTM5; lysosomal protein transmembrane 5; lysosomal multispanning membrane protein 5; lysosomal-associated transmembrane protein 5; retinoic acid-inducible E3 protein; human retinoic acid-inducible E3 protein; CD40-ligand-activated specific transcripts; lysosomal-associated multitransmembrane protein 5; lysosomal associated multispanning membrane protein 5; CLAST6; FLJ61683; FLJ97251; MGC125860; MGC125861;
Gene ID 7805
mRNA Refseq NM_006762
Protein Refseq NP_006753
MIM 601476
UniProt ID Q13571

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAPTM5 Products

Required fields are marked with *

My Review for All LAPTM5 Products

Required fields are marked with *

0
cart-icon
0
compare icon