Recombinant Human LAPTM5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LAPTM5-3237H
• Product Overview: LAPTM5 MS Standard C13 and N15-labeled recombinant protein (NP_006753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis.
• Molecular Mass: 29.9 kDa
• AA Sequence: MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKKNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LAPTM5 lysosomal protein transmembrane 5 [ Homo sapiens (human) ]
• Official Symbol: LAPTM5
• Synonyms: LAPTM5; lysosomal protein transmembrane 5; lysosomal multispanning membrane protein 5; lysosomal-associated transmembrane protein 5; retinoic acid-inducible E3 protein; human retinoic acid-inducible E3 protein; CD40-ligand-activated specific transcripts; lysosomal-associated multitransmembrane protein 5; lysosomal associated multispanning membrane protein 5; CLAST6; FLJ61683; FLJ97251; MGC125860; MGC125861
• Gene ID: 7805
• mRNA Refseq: NM_006762
• Protein Refseq: NP_006753
• MIM: 601476
• UniProt ID: Q13571