Recombinant Human LARP1 protein, His-tagged
| Cat.No. : | LARP1-17H |
| Product Overview : | Recombinant Human LARP1 protein(Q6PKG0)(141-490 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 141-490 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 42 kDa |
| AASequence : | GQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVD |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.1-1.0 mg/ml |
| Gene Name | LARP1 La ribonucleoprotein domain family, member 1 [ Homo sapiens ] |
| Official Symbol | LARP1 |
| Synonyms | LARP1; La ribonucleoprotein domain family, member 1; la-related protein 1; KIAA0731; LARP; MGC19556; |
| Gene ID | 23367 |
| mRNA Refseq | NM_015315 |
| Protein Refseq | NP_056130 |
| MIM | 612059 |
| UniProt ID | Q6PKG0 |
| ◆ Recombinant Proteins | ||
| LARP1-17H | Recombinant Human LARP1 protein, His-tagged | +Inquiry |
| LARP1-18H | Recombinant Human LARP1, GST-tagged | +Inquiry |
| LARP1-29045TH | Recombinant Human LARP1, His-tagged | +Inquiry |
| LARP1-6966HF | Recombinant Full Length Human LARP1 Protein, GST-tagged | +Inquiry |
| LARP1-19H | Recombinant Human LARP1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LARP1-969HCL | Recombinant Human LARP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LARP1 Products
Required fields are marked with *
My Review for All LARP1 Products
Required fields are marked with *



