Recombinant Human LCE3A Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LCE3A-553H |
| Product Overview : | LCE3A MS Standard C13 and N15-labeled recombinant protein (NP_848518) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Precursors of the cornified envelope of the stratum corneum. |
| Molecular Mass : | 9 kDa |
| AA Sequence : | MSCQQNQQQCQPPPKCPAKSPAQCLPPASSSCAPSSGGCGPSSERSCCLSHHRCRRSHRCRCQSSNSCDRGSGQQGGSSSCGHSSAGCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LCE3A late cornified envelope 3A [ Homo sapiens (human) ] |
| Official Symbol | LCE3A |
| Synonyms | LCE3A; late cornified envelope 3A; LEP13; late cornified envelope protein 3A; late envelope protein 13 |
| Gene ID | 353142 |
| mRNA Refseq | NM_178431 |
| Protein Refseq | NP_848518 |
| MIM | 612613 |
| UniProt ID | Q5TA76 |
| ◆ Recombinant Proteins | ||
| LCE3A-553H | Recombinant Human LCE3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LCE3A-2195H | Recombinant Human LCE3A Protein (1-89 aa), His-tagged | +Inquiry |
| LCE3A-340H | Recombinant Human LCE3A Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCE3A Products
Required fields are marked with *
My Review for All LCE3A Products
Required fields are marked with *
