Recombinant Human LCE3E Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LCE3E-4419H
• Product Overview: LCE3E MS Standard C13 and N15-labeled recombinant protein (NP_848522) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Precursors of the cornified envelope of the stratum corneum.
• Molecular Mass: 9.5 kDa
• AA Sequence: MSCQQNQKQCQPPPKCPSPKCPPKNPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRSNSCDRGSGQQGGGSGCCHGSGGCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LCE3E late cornified envelope 3E [ Homo sapiens (human) ]
• Official Symbol: LCE3E
• Synonyms: LCE3E; late cornified envelope 3E; LEP17; late cornified envelope protein 3E; late envelope protein 17
• Gene ID: 353145
• mRNA Refseq: NM_178435
• Protein Refseq: NP_848522
• MIM: 612617
• UniProt ID: Q5T5B0