Recombinant Human LCE3E Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LCE3E-4419H
Product Overview : LCE3E MS Standard C13 and N15-labeled recombinant protein (NP_848522) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Precursors of the cornified envelope of the stratum corneum.
Molecular Mass : 9.5 kDa
AA Sequence : MSCQQNQKQCQPPPKCPSPKCPPKNPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRSNSCDRGSGQQGGGSGCCHGSGGCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LCE3E late cornified envelope 3E [ Homo sapiens (human) ]
Official Symbol LCE3E
Synonyms LCE3E; late cornified envelope 3E; LEP17; late cornified envelope protein 3E; late envelope protein 17
Gene ID 353145
mRNA Refseq NM_178435
Protein Refseq NP_848522
MIM 612617
UniProt ID Q5T5B0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCE3E Products

Required fields are marked with *

My Review for All LCE3E Products

Required fields are marked with *

0
cart-icon
0
compare icon