Recombinant Human LCK Protein (SH3 Domain), GST tagged

Cat.No. : LCK-174H
Product Overview : Recombinant Human LCK Protein (SH3 Domain) with GST tag was expressed in E. coli.
Availability September 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants encoding different isoforms have been described.
Form : Lyophilized
Molecular Mass : The protein has a calculated MW of 33 kDa.
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANS
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from sterile 50 mM Tris, pH8.0, 200 mM NaCl, 1mM DTT, 5% Mannitol, 5% Trehalose
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.42 μg/μL. Centrifuge the vial at 4 centigarde before opening to recover the entire contents.
Gene Name LCK lymphocyte-specific protein tyrosine kinase [ Homo sapiens ]
Official Symbol LCK
Synonyms LCK; lymphocyte-specific protein tyrosine kinase; tyrosine-protein kinase Lck; leukocyte C-terminal Src kinase; p56(LSTRA) protein-tyrosine kinase; t cell-specific protein-tyrosine kinase; proto-oncogene tyrosine-protein kinase LCK; lymphocyte cell-specific protein-tyrosine kinase; T-lymphocyte specific protein tyrosine kinase p56lck; LSK; YT16; p56lck; pp58lck;
Gene ID 3932
mRNA Refseq NM_001042771
Protein Refseq NP_001036236
MIM 153390
UniProt ID P06239

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCK Products

Required fields are marked with *

My Review for All LCK Products

Required fields are marked with *

0
cart-icon