Recombinant Human LCN15 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LCN15-4730H
Product Overview : LCN15 MS Standard C13 and N15-labeled recombinant protein (NP_976222) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LCN15 (Lipocalin 15) is a Protein Coding gene. Diseases associated with LCN15 include Retrograde Amnesia. Among its related pathways are Transport of vitamins, nucleosides, and related molecules and Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds. Gene Ontology (GO) annotations related to this gene include transporter activity and small molecule binding. An important paralog of this gene is PTGDS.
Molecular Mass : 20.5 kDa
AA Sequence : MMSFLLGAILTLLWAPTAQAEVLLQPDFNAEKFSGLWYVVSMASDCRVFLGKKDHLSMSTRAIRPTEEGGLHVHMEFPGADGCNQVDAEYLKVGSEGHFRVPALGYLDVRIVDTDYSSFAVLYIYKELEGALSTMVQLYSRTQDVSPQALKSFQDFYPTLGLPKDMMVMLPQSDACNPESKEAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LCN15 lipocalin 15 [ Homo sapiens (human) ]
Official Symbol LCN15
Synonyms LCN15; lipocalin 15; PRO6093; UNQ2541; lipocalin-15; MSFL2541; EC 5.3.99.2
Gene ID 389812
mRNA Refseq NM_203347
Protein Refseq NP_976222
UniProt ID Q6UWW0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCN15 Products

Required fields are marked with *

My Review for All LCN15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon