Recombinant Human LCN15 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LCN15-4730H |
| Product Overview : | LCN15 MS Standard C13 and N15-labeled recombinant protein (NP_976222) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | LCN15 (Lipocalin 15) is a Protein Coding gene. Diseases associated with LCN15 include Retrograde Amnesia. Among its related pathways are Transport of vitamins, nucleosides, and related molecules and Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds. Gene Ontology (GO) annotations related to this gene include transporter activity and small molecule binding. An important paralog of this gene is PTGDS. |
| Molecular Mass : | 20.5 kDa |
| AA Sequence : | MMSFLLGAILTLLWAPTAQAEVLLQPDFNAEKFSGLWYVVSMASDCRVFLGKKDHLSMSTRAIRPTEEGGLHVHMEFPGADGCNQVDAEYLKVGSEGHFRVPALGYLDVRIVDTDYSSFAVLYIYKELEGALSTMVQLYSRTQDVSPQALKSFQDFYPTLGLPKDMMVMLPQSDACNPESKEAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LCN15 lipocalin 15 [ Homo sapiens (human) ] |
| Official Symbol | LCN15 |
| Synonyms | LCN15; lipocalin 15; PRO6093; UNQ2541; lipocalin-15; MSFL2541; EC 5.3.99.2 |
| Gene ID | 389812 |
| mRNA Refseq | NM_203347 |
| Protein Refseq | NP_976222 |
| UniProt ID | Q6UWW0 |
| ◆ Recombinant Proteins | ||
| LCN15-3821H | Recombinant Human LCN15 Protein (Pro26-Leu170), N-GST tagged | +Inquiry |
| LCN15-524H | Recombinant Human LCN15, GST-tagged | +Inquiry |
| LCN15-2478R | Recombinant Rhesus monkey LCN15 Protein, His-tagged | +Inquiry |
| LCN15-4730H | Recombinant Human LCN15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LCN15-4371Z | Recombinant Zebrafish LCN15 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LCN15-4800HCL | Recombinant Human LCN15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCN15 Products
Required fields are marked with *
My Review for All LCN15 Products
Required fields are marked with *
