Recombinant Human LCOR Protein, GST-tagged

Cat.No. : LCOR-5396H
Product Overview : Human MLR2 partial ORF ( NP_115816.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box (Fernandes et al., 2003 [PubMed 12535528]).[supplied by OMIM
Molecular Mass : 36.74 kDa
AA Sequence : MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCAGSTSLSH
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LCOR ligand dependent nuclear receptor corepressor [ Homo sapiens ]
Official Symbol LCOR
Synonyms LCOR; ligand dependent nuclear receptor corepressor; ligand-dependent corepressor; FLJ38026; KIAA1795; MLR2; mblk1-related protein 2; RP11-175O19.1;
Gene ID 84458
mRNA Refseq NM_001170765
Protein Refseq NP_001164236
MIM 607698
UniProt ID Q96JN0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCOR Products

Required fields are marked with *

My Review for All LCOR Products

Required fields are marked with *

0
cart-icon