Recombinant Human LCP2

Cat.No. : LCP2-30444TH
Product Overview : Recombinant full length Human SLP76 with N terminal proprietary tag, predicted mwt: 84.74kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 533 amino acids
Description : SLP-76 was originally identified as a substrate of the ZAP-70 protein tyrosine kinase following T cell receptor (TCR) ligation in the leukemic T cell line Jurkat. The SLP-76 locus has been localized to human chromosome 5q33 and the gene structure has been partially characterized in mice. The human and murine cDNAs both encode 533 amino acid proteins that are 72% identical and comprised of three modular domains. The NH2-terminus contains an acidic region that includes a PEST domain and several tyrosine residues which are phosphorylated following TCR ligation. SLP-76 also contains a central proline-rich domain and a COOH-terminal SH2 domain. A number of additional proteins have been identified that associate with SLP-76 both constitutively and inducibly following receptor ligation, supporting the notion that SLP-76 functions as an adaptor or scaffold protein. Studies using SLP-76 deficient T cell lines or mice have provided strong evidence that SLP-76 plays a positive role in promoting T cell development and activation as well as mast cell and platelet function.
Molecular Weight : 84.740kDa inclusive of tags
Tissue specificity : Highly expressed in spleen, thymus and peripheral blood leukocytes. Highly expressed also in T-cell and monocytic cell lines, expressed at lower level in B-cell lines. Not detected in fibroblast or neuroblastoma cell lines.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYH IDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRS IFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQ DGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSI LPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPP PAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK PPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRREND EDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHM PGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPL PLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKIN QDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGS RYQCTLTHAAGYP
Sequence Similarities : Contains 1 SAM (sterile alpha motif) domain.Contains 1 SH2 domain.
Gene Name LCP2 lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) [ Homo sapiens ]
Official Symbol LCP2
Synonyms LCP2; lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa); lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kD) , SLP76; lymphocyte cytosolic protein 2; 76 kDa tyrosine phosphoprotein; SH2 domain c
Gene ID 3937
mRNA Refseq NM_005565
Protein Refseq NP_005556
MIM 601603
Uniprot ID Q13094
Chromosome Location 5q33.1-qter
Pathway Adaptive Immune System, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Fc epsilon RI signaling pathway, organism-specific biosystem; Fc epsilon RI signaling pathway, conserved biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LCP2 Products

Required fields are marked with *

My Review for All LCP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon