Recombinant Human LDAH Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LDAH-1745H
• Product Overview: C2orf43 MS Standard C13 and N15-labeled recombinant protein (NP_068744) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Serine lipid hydrolase associated with lipid droplets. Highly expressed in macrophage-rich areas in atherosclerotic lesions, suggesting that it could promote cholesterol ester turnover in macrophages.
• Molecular Mass: 37.3 kDa
• AA Sequence: MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSLTNRRFPVWTISHAGHALAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFITHFNQEMADMIADSLKDDLSKMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LDAH lipid droplet associated hydrolase [ Homo sapiens (human) ]
• Official Symbol: LDAH
• Synonyms: LDAH; lipid droplet associated hydrolase; hLDAH; C2orf43; lipid droplet-associated hydrolase; UPF0554 protein C2orf43; lipid droplet-associated serine hydrolase
• Gene ID: 60526
• mRNA Refseq: NM_021925
• Protein Refseq: NP_068744
• MIM: 613570
• UniProt ID: Q9H6V9