Recombinant Human LDLR protein(31-100 aa), C-His-tagged
Cat.No. : | LDLR-2506H |
Product Overview : | Recombinant Human LDLR protein(P01130)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-100 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSD |
Gene Name | LDLR low density lipoprotein receptor [ Homo sapiens ] |
Official Symbol | LDLR |
Synonyms | LDLR; low density lipoprotein receptor; low-density lipoprotein receptor; familial hypercholesterolemia; LDL receptor; low-density lipoprotein receptor class A domain-containing protein 3; FH; FHC; LDLCQ2; |
Gene ID | 3949 |
mRNA Refseq | NM_000527 |
Protein Refseq | NP_000518 |
MIM | 606945 |
UniProt ID | P01130 |
◆ Recombinant Proteins | ||
LDLR-3666H | Recombinant Human LDLR protein, GST-tagged | +Inquiry |
LDLR-29938TH | Recombinant Human LDLR | +Inquiry |
Ldlr-3283M | Recombinant Mouse Ldlr protein(Met1-Arg790), His-tagged | +Inquiry |
LDLR-2674H | Active Recombinant Human LDLR protein, His-tagged | +Inquiry |
LDLR-266H | Recombinant Human LDLR protein, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
LDLR-85H | Native Human Lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDLR-2780HCL | Recombinant Human LDLR cell lysate | +Inquiry |
LDLR-2762MCL | Recombinant Mouse LDLR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDLR Products
Required fields are marked with *
My Review for All LDLR Products
Required fields are marked with *