Recombinant Human LDLRAP1 protein, GST-tagged

Cat.No. : LDLRAP1-301431H
Product Overview : Recombinant Human LDLRAP1 (1-308 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Phe308
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name LDLRAP1 low density lipoprotein receptor adaptor protein 1 [ Homo sapiens ]
Official Symbol LDLRAP1
Synonyms LDLRAP1; low density lipoprotein receptor adaptor protein 1; low density lipoprotein receptor adapter protein 1; ARH; ARH2; DKFZp586D0624; FHCB1; FHCB2; MGC34705; LDL receptor adaptor protein; autosomal recessive hypercholesterolemia protein; ARH1;
Gene ID 26119
mRNA Refseq NM_015627
Protein Refseq NP_056442
MIM 605747
UniProt ID Q5SW96

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDLRAP1 Products

Required fields are marked with *

My Review for All LDLRAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon