Recombinant Human LDLRAP1 protein, GST-tagged
Cat.No. : | LDLRAP1-301431H |
Product Overview : | Recombinant Human LDLRAP1 (1-308 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Phe308 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LDLRAP1 low density lipoprotein receptor adaptor protein 1 [ Homo sapiens ] |
Official Symbol | LDLRAP1 |
Synonyms | LDLRAP1; low density lipoprotein receptor adaptor protein 1; low density lipoprotein receptor adapter protein 1; ARH; ARH2; DKFZp586D0624; FHCB1; FHCB2; MGC34705; LDL receptor adaptor protein; autosomal recessive hypercholesterolemia protein; ARH1; |
Gene ID | 26119 |
mRNA Refseq | NM_015627 |
Protein Refseq | NP_056442 |
MIM | 605747 |
UniProt ID | Q5SW96 |
◆ Recombinant Proteins | ||
Ldlrap1-7874M | Recombinant Mouse Ldlrap1 protein, His & T7-tagged | +Inquiry |
LDLRAP1-301431H | Recombinant Human LDLRAP1 protein, GST-tagged | +Inquiry |
LDLRAP1-1396H | Recombinant Human Low Density Lipoprotein Receptor Adaptor Protein 1, His-tagged | +Inquiry |
LDLRAP1-5026M | Recombinant Mouse LDLRAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ldlrap1-005M | Recombinant Mouse Ldlrap1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDLRAP1-4784HCL | Recombinant Human LDLRAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDLRAP1 Products
Required fields are marked with *
My Review for All LDLRAP1 Products
Required fields are marked with *