Recombinant Human LDOC1 protein, GST-tagged
| Cat.No. : | LDOC1-3671H |
| Product Overview : | Recombinant Human LDOC1 protein(1-146 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-146 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LDOC1 leucine zipper, down-regulated in cancer 1 [ Homo sapiens ] |
| Official Symbol | LDOC1 |
| Synonyms | LDOC1; leucine zipper, down-regulated in cancer 1; BCUR1; protein LDOC1; Mar7; Mart7; breast cancer, up-regulated 1; leucine zipper protein down-regulated in cancer cells; |
| Gene ID | 23641 |
| mRNA Refseq | NM_012317 |
| Protein Refseq | NP_036449 |
| MIM | 300402 |
| UniProt ID | O95751 |
| ◆ Recombinant Proteins | ||
| LDOC1-538H | Recombinant Human LDOC1, GST-tagged | +Inquiry |
| Ldoc1-1733M | Recombinant Mouse Ldoc1 Protein, His&GST-tagged | +Inquiry |
| LDOC1-5027M | Recombinant Mouse LDOC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ldoc1-3769M | Recombinant Mouse Ldoc1 Protein, Myc/DDK-tagged | +Inquiry |
| LDOC1-3671H | Recombinant Human LDOC1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LDOC1-4783HCL | Recombinant Human LDOC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDOC1 Products
Required fields are marked with *
My Review for All LDOC1 Products
Required fields are marked with *
