Recombinant Human LEAP2 Protein, His tagged

• Cat.No.: LEAP2-158H
• Product Overview: Recombinant Human LEAP2 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-77 aa
• Description: This gene encodes a cysteine-rich cationic antimicrobial peptide that is expressed predominantly in the liver. The mature peptide has activity against gram-positive bacteria and yeasts.
• Form: Sterile PBS, pH7.4, 0.1% SKL
• Molecular Mass: 10 kDa
• AASequence: MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQEHHHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: LEAP2 liver expressed antimicrobial peptide 2 [ Homo sapiens (human) ]
• Official Symbol: LEAP2
• Synonyms: LEAP2; liver enriched antimicrobial peptide 2; LEAP-2; liver-expressed antimicrobial peptide 2
• Gene ID: 116842
• mRNA Refseq: NM_052971
• Protein Refseq: NP_443203
• MIM: 611373
• UniProt ID: Q969E1