Recombinant Human LEF1 protein, His-tagged
Cat.No. : | LEF1-7687H |
Product Overview : | Recombinant Human LEF1 protein(1-98 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-98 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPD |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | LEF1 lymphoid enhancer-binding factor 1 [ Homo sapiens ] |
Official Symbol | LEF1 |
Synonyms | LEF1; lymphoid enhancer-binding factor 1; TCF1ALPHA; TCF7L3; TCF10; TCF1-alpha; T cell-specific transcription factor 1-alpha; LEF-1; FLJ46390; DKFZp586H0919; |
mRNA Refseq | NM_001130713 |
Protein Refseq | NP_001124185 |
UniProt ID | Q9UJU2 |
Gene ID | 51176 |
◆ Recombinant Proteins | ||
LEF1-4817H | Recombinant Human LEF1 Protein (Glu45-His260), N-His tagged | +Inquiry |
LEF1-8995Z | Recombinant Zebrafish LEF1 | +Inquiry |
LEF1-5032M | Recombinant Mouse LEF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LEF1-3373R | Recombinant Rat LEF1 Protein | +Inquiry |
LEF1-166H | Recombinant Human LEF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEF1-4778HCL | Recombinant Human LEF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEF1 Products
Required fields are marked with *
My Review for All LEF1 Products
Required fields are marked with *
0
Inquiry Basket