Recombinant Human LEFTY2 Protein, C-His tagged

Cat.No. : LEFTY2-002H
Product Overview : Recombinant Human LEFTY2 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. This gene is closely linked to both a related family member and a related pseudogene. This gene encodes multiple isoforms that may undergo similar proteolytic processing.
Molecular Mass : 33.7 kDa
AA Sequence : RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQPDDDDKHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.28 mg/mL
Storage Buffer : PBS, pH 7.4
Gene Name LEFTY2 left-right determination factor 2 [ Homo sapiens (human) ]
Official Symbol LEFTY2
Synonyms LEFTY2; left-right determination factor 2; EBAF, endometrial bleeding associated factor (left right determination, factor A; transforming growth factor beta superfamily) , TGFB4; LEFTA; LEFTYA; transforming growth factor; beta 4 (endometrial bleeding associated factor; LEFTY A); TGF-beta-4; protein lefty-2; protein lefty-A; left-right determination factor A; transforming growth factor beta-4; endometrial bleeding-associated factor; EBAF; TGFB4; MGC46222;
Gene ID 7044
mRNA Refseq NM_003240
Protein Refseq NP_003231
MIM 601877
UniProt ID O00292

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEFTY2 Products

Required fields are marked with *

My Review for All LEFTY2 Products

Required fields are marked with *

0
cart-icon