Recombinant Human LEFTY2 protein, His-tagged

Cat.No. : LEFTY2-501H
Product Overview : Recombinant Human LEFTY2 protein(NP_003231)(24-366 aa), fused to His tag, was expressed in E. coli.
Availability February 04, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 24-366 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : EEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Purity : 70%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name LEFTY2 left-right determination factor 2 [ Homo sapiens ]
Official Symbol LEFTY2
Synonyms LEFTY2; left-right determination factor 2; EBAF, endometrial bleeding associated factor (left right determination, factor A; transforming growth factor beta superfamily) , TGFB4; LEFTA; LEFTYA; transforming growth factor; beta 4 (endometrial bleeding associated factor; LEFTY A); TGF-beta-4; protein lefty-2; protein lefty-A; left-right determination factor A; transforming growth factor beta-4; endometrial bleeding-associated factor; EBAF; TGFB4; MGC46222;
Gene ID 7044
mRNA Refseq NM_003240
Protein Refseq NP_003231
UniProt ID O00292

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEFTY2 Products

Required fields are marked with *

My Review for All LEFTY2 Products

Required fields are marked with *

0
cart-icon
0
compare icon