Recombinant Human LEFTY2 protein, His-tagged
| Cat.No. : | LEFTY2-501H |
| Product Overview : | Recombinant Human LEFTY2 protein(NP_003231)(24-366 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-366 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | EEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP |
| Purity : | 70%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | LEFTY2 left-right determination factor 2 [ Homo sapiens ] |
| Official Symbol | LEFTY2 |
| Synonyms | LEFTY2; left-right determination factor 2; EBAF, endometrial bleeding associated factor (left right determination, factor A; transforming growth factor beta superfamily) , TGFB4; LEFTA; LEFTYA; transforming growth factor; beta 4 (endometrial bleeding associated factor; LEFTY A); TGF-beta-4; protein lefty-2; protein lefty-A; left-right determination factor A; transforming growth factor beta-4; endometrial bleeding-associated factor; EBAF; TGFB4; MGC46222; |
| Gene ID | 7044 |
| mRNA Refseq | NM_003240 |
| Protein Refseq | NP_003231 |
| UniProt ID | O00292 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEFTY2 Products
Required fields are marked with *
My Review for All LEFTY2 Products
Required fields are marked with *



