Recombinant Human LEPRE1, His-tagged
Cat.No. : | LEPRE1-29940TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 322-736 of Human LEPRE1 with N terminal His tag; 415 amino acids, 52kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 322-736 a.a. |
Description : | This gene encodes an enzyme that is a member of the collagen prolyl hydroxylase family. These enzymes are localized to the endoplasmic reticulum and their activity is required for proper collagen synthesis and assembly. Mutations in this gene are associated with osteogenesis imperfecta type VIII. Three alternatively spliced transcript variants encoding different isoforms have been described. Other variants may exist, but their biological validity has not been determined. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 143 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ECAKTYLLFFPNDEVMNQNLAYYAAMLGEEHTRSIGPRES AKEYRQRSLLEKELLFFAYDVFGIPFVDPDSWTPEEVI PKRLQEKQKSERETAVRISQEIGNLMKEIETLVEEKTKESLDVSRLTREGGPLLYEGISLTMNSKLLNGSQRVVMDGV ISDHECQELQRLTNVAATSGDGYRGQTSPHTPNEKFYG VTVFKALKLGQEGKVPLQSAHLYYNVTEKVRRIMESYFRLDTPLYFSYSHLVCRTAIEEVQAERKDDSHPVHVDNCIL NAETLVCVKEPPAYTFRDYSAILYLNGDFDGGNFYFTE LDAKTVTAEVQPQCGRAVGFSSGTENPHGVKAVTRGQRCAIALWFTLDPRHSERDRVQADDLVKMLFSPEEMDLSQEQ PLDAQQGPPEPAQESLSGSESKPKDEL |
Gene Name | LEPRE1 leucine proline-enriched proteoglycan (leprecan) 1 [ Homo sapiens ] |
Official Symbol | LEPRE1 |
Synonyms | LEPRE1; leucine proline-enriched proteoglycan (leprecan) 1; prolyl 3-hydroxylase 1; GROS1; growth suppressor 1; LEPRECAN; MGC117314; P3H1; prolyl 3 hydroxylase 1; |
Gene ID | 64175 |
mRNA Refseq | NM_001146289 |
Protein Refseq | NP_001139761 |
MIM | 610339 |
Uniprot ID | Q32P28 |
Chromosome Location | 1p34.1 |
Function | L-ascorbic acid binding; binding; iron ion binding; metal ion binding; molecular_function; |
◆ Recombinant Proteins | ||
LEPRE1-29940TH | Recombinant Human LEPRE1, His-tagged | +Inquiry |
LEPRE1-3377R | Recombinant Rat LEPRE1 Protein | +Inquiry |
LEPRE1-2319R | Recombinant Rhesus Macaque LEPRE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LEPRE1-2498R | Recombinant Rhesus monkey LEPRE1 Protein, His-tagged | +Inquiry |
LEPRE1-1119C | Recombinant Chicken LEPRE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEPRE1-4772HCL | Recombinant Human LEPRE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEPRE1 Products
Required fields are marked with *
My Review for All LEPRE1 Products
Required fields are marked with *